Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VGLL4 Peptide - middle region

VGLL4 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0121, VGL-4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VGLL4 Rabbit Polyclonal Antibody (orb586655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121693

Preservative

Lyophilized powder

AA Sequence

HSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Heavy Chain Antibody
DF4828-01 100 µL

Ferritin Heavy Chain Antibody

Sign In for Pricing
View Details
Ferritin Heavy Chain Antibody
DF4828-02 200 µL

Ferritin Heavy Chain Antibody

Sign In for Pricing
View Details
Human ponticulin ELISA Kit
MBS161617-01 48 Well

Human ponticulin ELISA Kit

Sign In for Pricing
View Details
Human ponticulin ELISA Kit
MBS161617-02 96 Well

Human ponticulin ELISA Kit

Sign In for Pricing
View Details
Human ponticulin ELISA Kit
MBS161617-03 5x 96 Well

Human ponticulin ELISA Kit

Sign In for Pricing
View Details
Human ponticulin ELISA Kit
MBS161617-04 10x 96 Well

Human ponticulin ELISA Kit

Sign In for Pricing
View Details