Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VGLL4 Peptide - middle region

VGLL4 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0121, VGL-4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VGLL4 Rabbit Polyclonal Antibody (orb586655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121693

Preservative

Lyophilized powder

AA Sequence

HSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Anoctamin-4 (ANO4) ELISA Kit
MBS7211732-01 48 Well

Monkey Anoctamin-4 (ANO4) ELISA Kit

Sign In for Pricing
View Details
Monkey Anoctamin-4 (ANO4) ELISA Kit
MBS7211732-02 96 Well

Monkey Anoctamin-4 (ANO4) ELISA Kit

Sign In for Pricing
View Details
Monkey Anoctamin-4 (ANO4) ELISA Kit
MBS7211732-03 5x 96 Well

Monkey Anoctamin-4 (ANO4) ELISA Kit

Sign In for Pricing
View Details
Monkey Anoctamin-4 (ANO4) ELISA Kit
MBS7211732-04 10x 96 Well

Monkey Anoctamin-4 (ANO4) ELISA Kit

Sign In for Pricing
View Details
MGMT Antibody
MBS9436013-01 0.05 mL

MGMT Antibody

Sign In for Pricing
View Details
MGMT Antibody
MBS9436013-02 0.1 mL

MGMT Antibody

Sign In for Pricing
View Details