Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VKORC1L1 Peptide - C-terminal region

VKORC1L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp762H0113

UniProt

Q8N0U8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_775788

Preservative

Lyophilized powder

AA Sequence

LAYILYFVLKEFCIICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (OKT3), 0.2mg/mL
BNUB0268-100 1x 100 µL

CD3e (T-Cell Marker) (OKT3), 0.2mg/mL

Sign In for Pricing
View Details
Human HOMER3 activation kit by CRISPRa
GA106314 1 Kit

Human HOMER3 activation kit by CRISPRa

Sign In for Pricing
View Details
GAB1 (NM_002039) Human Over-expression Lysate
LY400746 100 µg

GAB1 (NM_002039) Human Over-expression Lysate

Sign In for Pricing
View Details
A4GALT (NM_017436) Human Over-expression Lysate
LY402588 100 µg

A4GALT (NM_017436) Human Over-expression Lysate

Sign In for Pricing
View Details
SMAD3 Rabbit Polyclonal Antibody
AP08074PU-S 50 µL

SMAD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stk26 Mouse Gene Knockout Kit (CRISPR)
KN500273 1 Kit

Stk26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details