Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VKORC1L1 Peptide - C-terminal region

VKORC1L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp762H0113

UniProt

Q8N0U8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_775788

Preservative

Lyophilized powder

AA Sequence

LAYILYFVLKEFCIICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Vitamin D-Binding Protein, CF®740 Conjugate
#70091 1x 1 mL

Recombinant Human Vitamin D-Binding Protein, CF®740 Conjugate

Sign In for Pricing
View Details
Recombinant Haptoglobin Antibody
RC-15218-01 50 μL

Recombinant Haptoglobin Antibody

Sign In for Pricing
View Details
Recombinant Haptoglobin Antibody
RC-15218-02 100 µL

Recombinant Haptoglobin Antibody

Sign In for Pricing
View Details
Recombinant Haptoglobin Antibody
RC-15218-03 1 mL

Recombinant Haptoglobin Antibody

Sign In for Pricing
View Details
Hmgb4 (NM_027036) Mouse Tagged ORF Clone
MG201627 10 µg

Hmgb4 (NM_027036) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human CNTNAP3 activation kit by CRISPRa
GA112743 1 Kit

Human CNTNAP3 activation kit by CRISPRa

Sign In for Pricing
View Details