Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACYP1 Peptide - middle region

ACYP1 Peptide - middle region

Product Specifications

Product Name Alternative

ACYPE

UniProt

P07311

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACYP1 Rabbit Polyclonal Antibody (orb331363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001098

Preservative

Lyophilized powder

AA Sequence

LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP38 (FKBP8) Human Gene Knockout Kit (CRISPR)
KN416639 1 Kit

FKBP38 (FKBP8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
U-0521
TRC-U850325-50MG 50 mg

U-0521

Sign In for Pricing
View Details
Uncoated Mouse ALB (Albumin) ELISA Kit
E-UNEL-M0183-01 5x 96 Tests

Uncoated Mouse ALB (Albumin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse ALB (Albumin) ELISA Kit
E-UNEL-M0183-02 15x 96 Tests

Uncoated Mouse ALB (Albumin) ELISA Kit

Sign In for Pricing
View Details
CPN1 (NM_001308) Human Over-expression Lysate
LY420016 100 µg

CPN1 (NM_001308) Human Over-expression Lysate

Sign In for Pricing
View Details
RNase-Free Calf Thymus DNA, 1 mg/mL (1 mL)
#31065 1x 1 mL

RNase-Free Calf Thymus DNA, 1 mg/mL (1 mL)

Sign In for Pricing
View Details