Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARSJ Peptide - C-terminal region

ARSJ Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ23548

UniProt

Q5FYB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARSJ Rabbit Polyclonal Antibody (orb326630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078866

Preservative

Lyophilized powder

AA Sequence

VWGPWYKEETKKKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg101 Mouse Gene Knockout Kit (CRISPR)
KN501727 1 Kit

Atg101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Akirin2 Mouse Gene Knockout Kit (CRISPR)
KN501078 1 Kit

Akirin2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EEF1DP3 Human qPCR Primer Pair (BC021729)
HP223618 200 Reactions

EEF1DP3 Human qPCR Primer Pair (BC021729)

Sign In for Pricing
View Details
Butyrylcholinesterase (BCHE) Rabbit Polyclonal Antibody
AP14658PU-N 400 µL

Butyrylcholinesterase (BCHE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD1d Antibody[19G11]
E-AB-F10320-01 100 µg

AF/LE Purified Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD1d Antibody[19G11]
E-AB-F10320-02 1 mg

AF/LE Purified Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details