ATF7IP2 Peptide - N-terminal region
ATF7IP2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ12668, MCAF2
UniProt
Q5U623
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATF7IP2 Rabbit Polyclonal Antibody (orb586660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001243089
Preservative
Lyophilized powder
AA Sequence
EEIVHSETKLEQVVCSYQKPSRTTESPSRVFTEEAKDSLNTSENDSEHQT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY401889 100 µg
Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Over-expression Lysate
Sign In for Pricing
View Details 
TP314180 20 µg
Cardiac Troponin T (TNNT2) (NM_000364) Human Recombinant Protein
Sign In for Pricing
View Details 
AP52126PU-N 400 µL
TIP30 (HTATIP2) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
