Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF7IP2 Peptide - N-terminal region

ATF7IP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ12668, MCAF2

UniProt

Q5U623

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATF7IP2 Rabbit Polyclonal Antibody (orb586660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243089

Preservative

Lyophilized powder

AA Sequence

EEIVHSETKLEQVVCSYQKPSRTTESPSRVFTEEAKDSLNTSENDSEHQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD2L Antibody
KC-46357-01 50 μL

C2CD2L Antibody

Sign In for Pricing
View Details
C2CD2L Antibody
KC-46357-02 100 µL

C2CD2L Antibody

Sign In for Pricing
View Details
C2CD2L Antibody
KC-46357-03 1 mL

C2CD2L Antibody

Sign In for Pricing
View Details
1,4-Bis(p-tolylamino)anthracene-9,10-dione
TRC-P768855-250MG 250 mg

1,4-Bis(p-tolylamino)anthracene-9,10-dione

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (rKRT/457), CF740 conjugate, 0.1mg/mL
BNC741876-500 1x 500 µL

Cytokeratin, Multi (Epithelial Marker) (rKRT/457), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR562106 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details