Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN2 Peptide - C-terminal region

CAPRIN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1QDC1, EEG-1, EEG1, FLJ11391, FLJ22569, KIAA1873, MGC102894, MGC134847, MGC134848, caprin-2

UniProt

Q6IMN6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPRIN2 Rabbit Polyclonal Antibody (orb586666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002259

Preservative

Lyophilized powder

AA Sequence

YKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Tyrosine protein kinase JAK2 (JAK2) ELISA kit
GTR10455633 96 Well

Guinea Pig Tyrosine protein kinase JAK2 (JAK2) ELISA kit

Sign In for Pricing
View Details
mmu-miR-324-3p miRNA Inhibitor
MIM01846 2x 5.0 nmol

mmu-miR-324-3p miRNA Inhibitor

Sign In for Pricing
View Details
RT PCR test for detection of paraoxonase 1 gene mutation (575A>G, rs662) (0,2 mL tube format)
T01125-50-T 60 Tests

RT PCR test for detection of paraoxonase 1 gene mutation (575A>G, rs662) (0,2 mL tube format)

Sign In for Pricing
View Details
SHD Antibody
MBS852768-01 0.1 mg

SHD Antibody

Sign In for Pricing
View Details
SHD Antibody
MBS852768-02 0.1 mL (AF635)

SHD Antibody

Sign In for Pricing
View Details
SHD Antibody
MBS852768-03 0.1 mL (AF610)

SHD Antibody

Sign In for Pricing
View Details