Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN2 Peptide - C-terminal region

CAPRIN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1QDC1, EEG-1, EEG1, FLJ11391, FLJ22569, KIAA1873, MGC102894, MGC134847, MGC134848, caprin-2

UniProt

Q6IMN6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPRIN2 Rabbit Polyclonal Antibody (orb586666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002259

Preservative

Lyophilized powder

AA Sequence

YKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2',5'-Diiodo-p-terphenyl
sc-260337 125 mg

2',5'-Diiodo-p-terphenyl

Sign In for Pricing
View Details
Lentiviral mouse Mcc shRNA (UAS) - Lentiviral mouse Mcc shRNA (UAS, RFP) plasmid
GTR15191665 1 Vial

Lentiviral mouse Mcc shRNA (UAS) - Lentiviral mouse Mcc shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
2-Bromo-4-fluoro-N- (2,2,2-trifluoroethyl) aniline
PC57093 1 Each

2-Bromo-4-fluoro-N- (2,2,2-trifluoroethyl) aniline

Sign In for Pricing
View Details
Clstn1 ORF Vector (Rat) (pORF)
16383016 1.0 µg DNA

Clstn1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MTUS2 Antibody - C-terminal region : FITC (ARP62854_P050-FITC)
ARP62854_P050-FITC 100 µL

MTUS2 Antibody - C-terminal region : FITC (ARP62854_P050-FITC)

Sign In for Pricing
View Details
ANXA2 Antibody
orb2672126-01 50 µL

ANXA2 Antibody

Sign In for Pricing
View Details