Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC3A Peptide - C-terminal region

CLEC3A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLECSF1, MGC129558, MGC129559

UniProt

O75596

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC3A Rabbit Polyclonal Antibody (orb326633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005743

Preservative

Lyophilized powder

AA Sequence

GKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Ras-related protein Rab-22A
E6091h 96 Tests

ELISA Kit For Ras-related protein Rab-22A

Sign In for Pricing
View Details
MAP3K12 Rabbit Polyclonal Antibody
TA324095 100 µL

MAP3K12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBXAS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2345606 1.0 µg DNA

TBXAS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
OPG Polyclonal Antibody, PerCP Conjugated
bs-20624R-PerCP-01 20 µL

OPG Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
OPG Polyclonal Antibody, PerCP Conjugated
bs-20624R-PerCP-02 100 µL

OPG Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
UBE2K rabbit pAb
ES10447-01 50 µL

UBE2K rabbit pAb

Sign In for Pricing
View Details