Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC3A Peptide - C-terminal region

CLEC3A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLECSF1, MGC129558, MGC129559

UniProt

O75596

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC3A Rabbit Polyclonal Antibody (orb326633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005743

Preservative

Lyophilized powder

AA Sequence

GKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAN26 Protein Vector (Human) (pPB-N-His)
PV139607 500 ng

TRNAN26 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal ZIM2 Antibody (OTI7G1) [FITC]
NBP2-74929F 0.1 mL

Mouse Monoclonal ZIM2 Antibody (OTI7G1) [FITC]

Sign In for Pricing
View Details
Decarboxyl ofloxacin
orb2942359-01 250 mg

Decarboxyl ofloxacin

Sign In for Pricing
View Details
Decarboxyl ofloxacin
orb2942359-02 100 mg

Decarboxyl ofloxacin

Sign In for Pricing
View Details
Decarboxyl ofloxacin
orb2942359-03 50 mg

Decarboxyl ofloxacin

Sign In for Pricing
View Details
ATTO 700 Alkin
orb3133003-01 10 mg

ATTO 700 Alkin

Sign In for Pricing
View Details