Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A5 Peptide - C-terminal region

COL6A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COL6A5, FLJ35880, VWA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL6A5 Rabbit Polyclonal Antibody (orb326635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694996

Preservative

Lyophilized powder

AA Sequence

RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad5 (NM_008541) Mouse Untagged Clone
MC216266 10 µg

Smad5 (NM_008541) Mouse Untagged Clone

Sign In for Pricing
View Details
Rab 18 (D-5) Alexa Fluor® 488
sc-393168 AF488 200 µg/mL

Rab 18 (D-5) Alexa Fluor® 488

Sign In for Pricing
View Details
Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)
MBS1308869-01 0.02 mg (E-Coli)

Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)
MBS1308869-02 0.1 mg (E-Coli)

Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)
MBS1308869-03 0.02 mg (Yeast)

Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)
MBS1308869-04 0.1 mg (Yeast)

Recombinant Acinetobacter sp. Cell division topological specificity factor (minE)

Sign In for Pricing
View Details