Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A5 Peptide - C-terminal region

COL6A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COL6A5, FLJ35880, VWA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL6A5 Rabbit Polyclonal Antibody (orb326635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694996

Preservative

Lyophilized powder

AA Sequence

RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FLT1 shRNA (UAS) - Lentiviral human FLT1 shRNA (UAS, RFP) plasmid
GTR15322816 1 Vial

Lentiviral human FLT1 shRNA (UAS) - Lentiviral human FLT1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
JAZF1 (NM_175061) Human Tagged ORF Clone Lentiviral Particle
RC207288L1V 200 µL

JAZF1 (NM_175061) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Scrg1 (NM_033499) Rat Untagged Clone
RN211411 10 µg

Scrg1 (NM_033499) Rat Untagged Clone

Sign In for Pricing
View Details
IGFALS ELISA Kit (Mouse) (OKCA00900)
OKCA00900 96 Well

IGFALS ELISA Kit (Mouse) (OKCA00900)

Sign In for Pricing
View Details
PLEKHS1 (C10orf81, Pleckstrin Homology Domain-containing Family S Member 1, PH Domain-containing Family S Member 1, Epididymis Luminal Protein 185, hEL185, C10orf81, FLJ23537) (AP)
MBS6133006-01 0.1 mL

PLEKHS1 (C10orf81, Pleckstrin Homology Domain-containing Family S Member 1, PH Domain-containing Family S Member 1, Epididymis Luminal Protein 185, hEL185, C10orf81, FLJ23537) (AP)

Sign In for Pricing
View Details
PLEKHS1 (C10orf81, Pleckstrin Homology Domain-containing Family S Member 1, PH Domain-containing Family S Member 1, Epididymis Luminal Protein 185, hEL185, C10orf81, FLJ23537) (AP)
MBS6133006-02 5x 0.1 mL

PLEKHS1 (C10orf81, Pleckstrin Homology Domain-containing Family S Member 1, PH Domain-containing Family S Member 1, Epididymis Luminal Protein 185, hEL185, C10orf81, FLJ23537) (AP)

Sign In for Pricing
View Details