Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLEC10 Peptide - N-terminal region

COLEC10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLL1, MGC118794, MGC118795

UniProt

Q9Y6Z7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COLEC10 Rabbit Polyclonal Antibody (orb586669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006429

Preservative

Lyophilized powder

AA Sequence

IKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

300?l tip box with ultra low retention tip BPIC-714
BPIC-714 1 Unit

300?l tip box with ultra low retention tip BPIC-714

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
Mouse Frrs1 activation kit by CRISPRa
GA203820 1 Kit

Mouse Frrs1 activation kit by CRISPRa

Sign In for Pricing
View Details
MDP1 (NM_138476) Human Recombinant Protein
TP308609 20 µg

MDP1 (NM_138476) Human Recombinant Protein

Sign In for Pricing
View Details