Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLEC10 Peptide - N-terminal region

COLEC10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLL1, MGC118794, MGC118795

UniProt

Q9Y6Z7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COLEC10 Rabbit Polyclonal Antibody (orb586669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006429

Preservative

Lyophilized powder

AA Sequence

IKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPALIN Antibody
KC-2436-01 50 μL

OPALIN Antibody

Sign In for Pricing
View Details
OPALIN Antibody
KC-2436-02 100 µL

OPALIN Antibody

Sign In for Pricing
View Details
OPALIN Antibody
KC-2436-03 1 mL

OPALIN Antibody

Sign In for Pricing
View Details
Human GNPDA2 activation kit by CRISPRa
GA115183 1 Kit

Human GNPDA2 activation kit by CRISPRa

Sign In for Pricing
View Details
KEL (NM_000420) Human Over-expression Lysate
LY400148 100 µg

KEL (NM_000420) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MCAF2 (ATF7IP2) activation kit by CRISPRa
GA112809 1 Kit

Human MCAF2 (ATF7IP2) activation kit by CRISPRa

Sign In for Pricing
View Details