Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYGN Peptide - C-terminal region

CRYGN Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119042, MGC119043, MGC119044, MGC119045

UniProt

Q8WXF5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRYGN Rabbit Polyclonal Antibody (orb586670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653328

Preservative

Lyophilized powder

AA Sequence

SRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FABP1 siRNA
abx901816-01 15 nmol

Human FABP1 siRNA

Sign In for Pricing
View Details
Human FABP1 siRNA
abx901816-02 30 nmol

Human FABP1 siRNA

Sign In for Pricing
View Details
Anti-ZNF324 (Rabbit, Polyclonal)
A123680 100 µL

Anti-ZNF324 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
Methyl 3- (4-Methylphenyl) oxirane-2-carboxylate
OR1002974-01 250 mg

Methyl 3- (4-Methylphenyl) oxirane-2-carboxylate

Sign In for Pricing
View Details
Methyl 3- (4-Methylphenyl) oxirane-2-carboxylate
OR1002974-02 500 mg

Methyl 3- (4-Methylphenyl) oxirane-2-carboxylate

Sign In for Pricing
View Details
Methyl 3- (4-Methylphenyl) oxirane-2-carboxylate
OR1002974-03 1 g

Methyl 3- (4-Methylphenyl) oxirane-2-carboxylate

Sign In for Pricing
View Details