Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC8 Peptide - C-terminal region

DNAJC8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSPC331, SPF31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC8 Rabbit Polyclonal Antibody (orb326637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055095

Preservative

Lyophilized powder

AA Sequence

REEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GTPBP4 Antibody
RC-5732-01 50 μL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Recombinant GTPBP4 Antibody
RC-5732-02 100 µL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Recombinant GTPBP4 Antibody
RC-5732-03 1 mL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Glypican 5 (GPC5) Rabbit Polyclonal Antibody
TA367577 100 µL

Glypican 5 (GPC5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENTHD1 (N-term) Rabbit Polyclonal Antibody
AP51435PU-N 400 µL

ENTHD1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GBA3 Antibody
KC-7291-01 50 μL

GBA3 Antibody

Sign In for Pricing
View Details