DNAJC8 Peptide - C-terminal region
DNAJC8 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HSPC331, SPF31
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAJC8 Rabbit Polyclonal Antibody (orb326637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055095
Preservative
Lyophilized powder
AA Sequence
REEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683800-100 1x 100 µL
Myoglobin (Muscle Cell Marker) (rMB/2105), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
