FKBP9 Peptide - C-terminal region
FKBP9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp586B1723, FKBP60, FKBP63, MGC126772, MGC138258, PPIase
UniProt
O95302
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FKBP9 Rabbit Polyclonal Antibody (orb586677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009201
Preservative
Lyophilized powder
AA Sequence
VASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042289-500 1x 500 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680334-500 1x 500 µL
Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881766-500 1x 500 µL
CD43 (T-Cell Marker) (SPN/1766R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details