Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR21 Peptide - C-terminal region

GPR21 Peptide - C-terminal region

Product Specifications

UniProt

Q99679

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR21 Rabbit Polyclonal Antibody (orb586678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005285

Preservative

Lyophilized powder

AA Sequence

MMLYAPAALIVCFTYFNIFRICQQHTKDISERQARFSSQSGETGEVQACP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NABC1 (BCAS1) (N-term) Rabbit Polyclonal Antibody
AP50349PU-N 400 µL

NABC1 (BCAS1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS700587 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
FOLR1 Rabbit Polyclonal Antibody
ER1901-95 100 µL

FOLR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 Recombinant Rabbit Monoclonal Antibody [JU08-39]
ET1706-42 100 µL

ZAP70 Recombinant Rabbit Monoclonal Antibody [JU08-39]

Sign In for Pricing
View Details
SLC6A1 (NM_003042) Human Over-expression Lysate
LY418938 100 µg

SLC6A1 (NM_003042) Human Over-expression Lysate

Sign In for Pricing
View Details
MSF (SEPT9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13A11]
TA812817BM 100 µL

MSF (SEPT9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13A11]

Sign In for Pricing
View Details