Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR21 Peptide - C-terminal region

GPR21 Peptide - C-terminal region

Product Specifications

UniProt

Q99679

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR21 Rabbit Polyclonal Antibody (orb586678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005285

Preservative

Lyophilized powder

AA Sequence

MMLYAPAALIVCFTYFNIFRICQQHTKDISERQARFSSQSGETGEVQACP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPLX1 (Center) Rabbit Polyclonal Antibody
AP51050PU-N 400 µL

CPLX1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human FLRT2 Protein (His Tag)
PKSH031164 100 µg

Recombinant Human FLRT2 Protein (His Tag)

Sign In for Pricing
View Details
DP2 (TFDP2) (NM_001178140) Human Over-expression Lysate
LY433045 100 µg

DP2 (TFDP2) (NM_001178140) Human Over-expression Lysate

Sign In for Pricing
View Details
Tartrazine
TRC-T007700-1G 1 g

Tartrazine

Sign In for Pricing
View Details
Transaldolase 1 (TALDO1) (NM_006755) Human Recombinant Protein
TP304049L 1 mg

Transaldolase 1 (TALDO1) (NM_006755) Human Recombinant Protein

Sign In for Pricing
View Details
CCR9 Rabbit Polyclonal Antibody
TA369021 100 µL

CCR9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details