Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR21 Peptide - C-terminal region

GPR21 Peptide - C-terminal region

Product Specifications

UniProt

Q99679

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR21 Rabbit Polyclonal Antibody (orb586679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005285

Preservative

Lyophilized powder

AA Sequence

FRICQQHTKDISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cecropin A (1-8) -Melittin (1-18) amide
PC16933-01 1 mg

Cecropin A (1-8) -Melittin (1-18) amide

Sign In for Pricing
View Details
Cecropin A (1-8) -Melittin (1-18) amide
PC16933-02 10 mg

Cecropin A (1-8) -Melittin (1-18) amide

Sign In for Pricing
View Details
Cecropin A (1-8) -Melittin (1-18) amide
PC16933-03 100 mg

Cecropin A (1-8) -Melittin (1-18) amide

Sign In for Pricing
View Details
Recombinant ASFV p30 Protein (aa 1-194)
VAng-0951Lsx-500g 500 µg

Recombinant ASFV p30 Protein (aa 1-194)

Sign In for Pricing
View Details
RFC1 Rabbit Polyclonal Antibody
APRab17048-01 20 µL

RFC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RFC1 Rabbit Polyclonal Antibody
APRab17048-02 50 µL

RFC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details