Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR21 Peptide - C-terminal region

GPR21 Peptide - C-terminal region

Product Specifications

UniProt

Q99679

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR21 Rabbit Polyclonal Antibody (orb586679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005285

Preservative

Lyophilized powder

AA Sequence

FRICQQHTKDISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC440093 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV812532 1.0 µg DNA

LOC440093 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Rab22A Rabbit mAb
MBS4761883-01 0.1 mL

Rab22A Rabbit mAb

Sign In for Pricing
View Details
Rab22A Rabbit mAb
MBS4761883-02 5x 0.1 mL

Rab22A Rabbit mAb

Sign In for Pricing
View Details
Human anti-human CK-MB mAb (B2)
E4A09G07-B2-50 50 µg

Human anti-human CK-MB mAb (B2)

Sign In for Pricing
View Details
Integrator complex subunit 3
AP84481 1 mg

Integrator complex subunit 3

Sign In for Pricing
View Details
TNF-R2 shRNA (m) Lentiviral Particles
sc-36690-V 200 µL

TNF-R2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details