GPR135 Peptide - C-terminal region
GPR135 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HUMNPIIY20
UniProt
Q8IZ08
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPR135 Rabbit Polyclonal Antibody (orb586682) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_072093
Preservative
Lyophilized powder
AA Sequence
SSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![GBP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E7]](https://cdn.genprice.uk/products/937/68dd1b65061270361ea13e3d/imageurl/ta500660am.webp)
TA500660AM 100 µL
GBP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E7]
Sign In for Pricing
View Details 
LY423780 100 µg
Olfactory receptor 10X1 (OR10X1) (NM_001004477) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC471133-500 1x 500 µL
CD74 (CLIP/1133), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC422382 20 µg
HSPC142 (BABAM1) (NM_001033549) Human Over-expression Lysate
Sign In for Pricing
View Details 
T-1701-2 2 mg
Texas Red Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-
Sign In for Pricing
View Details