Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR135 Peptide - C-terminal region

GPR135 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HUMNPIIY20

UniProt

Q8IZ08

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR135 Rabbit Polyclonal Antibody (orb586682) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072093

Preservative

Lyophilized powder

AA Sequence

SSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCBP1 Human Gene Knockout Kit (CRISPR)
KN400630 1 Kit

NCBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF568 conjugate, 0.1mg/mL
BNC682559-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF405S conjugate, 0.1mg/mL
BNC041389-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CLECL1 activation kit by CRISPRa
GA116000 1 Kit

Human CLECL1 activation kit by CRISPRa

Sign In for Pricing
View Details
ABCA8 Human Gene Knockout Kit (CRISPR)
KN415060 1 Kit

ABCA8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI8C4]
CF814282 100 µg

Nestin (NES) Mouse Monoclonal Antibody [Clone ID: OTI8C4]

Sign In for Pricing
View Details