Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPRIN2 Peptide - N-terminal region

GPRIN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GRIN2, KIAA0514, MGC15171

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPRIN2 Rabbit Polyclonal Antibody (orb586685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055511

Preservative

Lyophilized powder

AA Sequence

LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BORCS6 Antibody
KC-3375-01 50 μL

BORCS6 Antibody

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3375-02 100 µL

BORCS6 Antibody

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3375-03 1 mL

BORCS6 Antibody

Sign In for Pricing
View Details
Human SHISAL2A activation kit by CRISPRa
GA117681 1 Kit

Human SHISAL2A activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant EZR Antibody
RC-4813-01 50 μL

Recombinant EZR Antibody

Sign In for Pricing
View Details
Recombinant EZR Antibody
RC-4813-02 100 µL

Recombinant EZR Antibody

Sign In for Pricing
View Details