Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFJ Peptide - N-terminal region

H2AFJ Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10903, FLJ52230, H2AJ, MGC921

UniProt

Q9BTM1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with H2AFJ Rabbit Polyclonal Antibody (orb586687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808760

Preservative

Lyophilized powder

AA Sequence

AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gabrg2 activation kit by CRISPRa
GA201523 1 Kit

Mouse Gabrg2 activation kit by CRISPRa

Sign In for Pricing
View Details
PPIL2 Antibody
OC-037-01 50 μL

PPIL2 Antibody

Sign In for Pricing
View Details
PPIL2 Antibody
OC-037-02 100 µL

PPIL2 Antibody

Sign In for Pricing
View Details
PPIL2 Antibody
OC-037-03 1 mL

PPIL2 Antibody

Sign In for Pricing
View Details
Disperse Red 1 (Technical Grade)
TRC-D473475-5G 5 g

Disperse Red 1 (Technical Grade)

Sign In for Pricing
View Details
Human WDR31 activation kit by CRISPRa
GA114501 1 Kit

Human WDR31 activation kit by CRISPRa

Sign In for Pricing
View Details