Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFJ Peptide - N-terminal region

H2AFJ Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10903, FLJ52230, H2AJ, MGC921

UniProt

Q9BTM1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with H2AFJ Rabbit Polyclonal Antibody (orb586687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808760

Preservative

Lyophilized powder

AA Sequence

AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSC Rabbit Polyclonal Antibody
AP06642PU-N 100 µg

MSC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DUSP4 (NM_057158) Human Recombinant Protein
TP315252L 1 mg

DUSP4 (NM_057158) Human Recombinant Protein

Sign In for Pricing
View Details
RUVBL2 Rabbit Polyclonal Antibody
TA370206 100 µL

RUVBL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HER2 Antibody
8C12903-AAT 50 µg

HER2 Antibody

Sign In for Pricing
View Details
Benchtop High Speed Refrigerated Centrifuge BCBHR-203
BCBHR-203 1 Unit

Benchtop High Speed Refrigerated Centrifuge BCBHR-203

Sign In for Pricing
View Details
Recombinant Human ERK3/MAPK12 Protein (His & GST Tag)
PKSH030318 50 µg

Recombinant Human ERK3/MAPK12 Protein (His & GST Tag)

Sign In for Pricing
View Details