INTU Peptide - C-terminal region
INTU Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ41326, INT, KIAA1284, PDZD6, PDZK6
UniProt
Q9ULD6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTU Rabbit Polyclonal Antibody (orb326640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056508
Preservative
Lyophilized powder
AA Sequence
TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Butyl 3-(2,4-Dichlorophenyl)-2-oxo-1-oxaspiro[4.5]dec-3-en-4-yl Carbonate](https://cdn.genprice.uk/products/572/1408612838849/imageurl/trc-s240640-250mg.webp)
TRC-S240640-250MG 250 mg
Butyl 3-(2,4-Dichlorophenyl)-2-oxo-1-oxaspiro[4.5]dec-3-en-4-yl Carbonate
Sign In for Pricing
View Details 
BNCB1705-100 1x 100 µL
TCF4 (Transcription Factor 4) (TCF4/1705), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![p38 MAPK Recombinant Rabbit Multiclonal Antibody [PSH03-72]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81233/imageurl/ha722036.webp)
HA722036 100 µL
p38 MAPK Recombinant Rabbit Multiclonal Antibody [PSH03-72]
Sign In for Pricing
View Details 