Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTU Peptide - C-terminal region

INTU Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ41326, INT, KIAA1284, PDZD6, PDZK6

UniProt

Q9ULD6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTU Rabbit Polyclonal Antibody (orb326640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056508

Preservative

Lyophilized powder

AA Sequence

TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SAE1 Antibody
RC-5328-01 50 μL

Recombinant SAE1 Antibody

Sign In for Pricing
View Details
Recombinant SAE1 Antibody
RC-5328-02 100 µL

Recombinant SAE1 Antibody

Sign In for Pricing
View Details
Recombinant SAE1 Antibody
RC-5328-03 1 mL

Recombinant SAE1 Antibody

Sign In for Pricing
View Details
2-Benzylamino-2-phenylbutanol
TRC-B225990-10MG 10 mg

2-Benzylamino-2-phenylbutanol

Sign In for Pricing
View Details
Isovaleryl Chloride
TRC-I917590-5G 5 g

Isovaleryl Chloride

Sign In for Pricing
View Details
L-(-)-3-Phenyllactic Acid
TRC-P335553-2.5G 2.5 g

L-(-)-3-Phenyllactic Acid

Sign In for Pricing
View Details