ISOC1 Peptide - C-terminal region
ISOC1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CGI-111
UniProt
Q96CN7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ISOC1 Rabbit Polyclonal Antibody (orb586690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057132
Preservative
Lyophilized powder
AA Sequence
DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941187-100 1x 100 µL
PAX7 (PAX7/1187), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![VGLL1 Mouse Monoclonal Antibody [Clone ID: OTI6E1]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908912/imageurl/cf810655.webp)
BNC403287-500 1x 500 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3287), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473800-100 1x 100 µL
Myoglobin (Muscle Cell Marker) (rMB/2105), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![UNG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F8]](https://cdn.genprice.uk/products/937/6868c34d994c49e6dc3f3b8e/imageurl/ta503613am.webp)
TA503613AM 100 µL
UNG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F8]
Sign In for Pricing
View Details