Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISOC1 Peptide - C-terminal region

ISOC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-111

UniProt

Q96CN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISOC1 Rabbit Polyclonal Antibody (orb586690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057132

Preservative

Lyophilized powder

AA Sequence

DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RYK Human Gene Knockout Kit (CRISPR)
KN415449 1 Kit

RYK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MNK1 (MKNK1) Rabbit Polyclonal Antibody
TA361328 100 µL

MNK1 (MKNK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Retinoblastoma binding protein 1 (ARID4A) (NM_002892) Human Over-expression Lysate
LY419037 100 µg

Retinoblastoma binding protein 1 (ARID4A) (NM_002892) Human Over-expression Lysate

Sign In for Pricing
View Details
Junctional Adhesion MolecULe 1 (F11R) Human Gene Knockout Kit (CRISPR)
KN400004 1 Kit

Junctional Adhesion MolecULe 1 (F11R) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tau (T231) Antibody
KC-16699-01 50 μL

Tau (T231) Antibody

Sign In for Pricing
View Details
Tau (T231) Antibody
KC-16699-02 100 µL

Tau (T231) Antibody

Sign In for Pricing
View Details