Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL36 Peptide - C-terminal region

MRPL36 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRIP1, L36mt, MGC104245, MRP-L36, PRPL36, RPMJ

UniProt

Q9P0J6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL36 Rabbit Polyclonal Antibody (orb586706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115868

Preservative

Lyophilized powder

AA Sequence

PGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMFR (Center) Rabbit Polyclonal Antibody
AP50160PU-N 400 µL

AMFR (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Deethylterbutryne
TRC-D228585-50MG 50 mg

Deethylterbutryne

Sign In for Pricing
View Details
Biotin Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226B-01 25 µg

Biotin Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
Biotin Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226B-02 100 µg

Biotin Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-01 50 μL

WAPL Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-02 100 µL

WAPL Antibody

Sign In for Pricing
View Details