Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL36 Peptide - C-terminal region

MRPL36 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRIP1, L36mt, MGC104245, MRP-L36, PRPL36, RPMJ

UniProt

Q9P0J6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL36 Rabbit Polyclonal Antibody (orb586706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115868

Preservative

Lyophilized powder

AA Sequence

PGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MST4 (STK26) Human qPCR Primer Pair (NM_016542)
HP225694 200 Reactions

MST4 (STK26) Human qPCR Primer Pair (NM_016542)

Sign In for Pricing
View Details
MIR4652 Human qPCR Primer Pair (MI0017280)
HP301046 200 Reactions

MIR4652 Human qPCR Primer Pair (MI0017280)

Sign In for Pricing
View Details
Velneprit
TRC-V115000-5MG 5 mg

Velneprit

Sign In for Pricing
View Details
THYN1 Rabbit Polyclonal Antibody
TA365070 100 µL

THYN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 4-(tert-Butyl)benzenesulfonate
TRC-E701930-500MG 500 mg

Ethyl 4-(tert-Butyl)benzenesulfonate

Sign In for Pricing
View Details
FITC Anti-Human CD197/CCR7 Antibody[G043H7]
E-AB-F1159C-01 20 Tests

FITC Anti-Human CD197/CCR7 Antibody[G043H7]

Sign In for Pricing
View Details