Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSGN1 Peptide - C-terminal region

MSGN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSOG

UniProt

A6NI15

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSGN1 Rabbit Polyclonal Antibody (orb586707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099039

Preservative

Lyophilized powder

AA Sequence

HLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 5 Recombinant Rabbit monoclonal Antibody
HA723182 100 µL

Integrin beta 5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AK2 Human Gene Knockout Kit (CRISPR)
KN209974BN 1 Kit

AK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Oxoheptanedioic Acid
TRC-O870158-25MG 25 mg

4-Oxoheptanedioic Acid

Sign In for Pricing
View Details
C5orf60 Human Gene Knockout Kit (CRISPR)
KN427206 1 Kit

C5orf60 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
7-Phenyltridecane
TRC-P465370-50MG 50 mg

7-Phenyltridecane

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details