Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSGN1 Peptide - C-terminal region

MSGN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSOG

UniProt

A6NI15

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSGN1 Rabbit Polyclonal Antibody (orb586707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099039

Preservative

Lyophilized powder

AA Sequence

HLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike RBD (I472V) (His Tag)
PKSV030431 100 µg

Recombinant SARS-CoV-2 Spike RBD (I472V) (His Tag)

Sign In for Pricing
View Details
5-Oxo-1-propyl-2-pyrrolidineacetic Acid
TRC-O859020-1G 1 g

5-Oxo-1-propyl-2-pyrrolidineacetic Acid

Sign In for Pricing
View Details
2,4-Dihydro-4-[4-[4-(4-hydroxyphenyl)-1-piperazinyl]phenyl]-3H-1,2,4-triazol-3-one
TRC-D449060-50MG 50 mg

2,4-Dihydro-4-[4-[4-(4-hydroxyphenyl)-1-piperazinyl]phenyl]-3H-1,2,4-triazol-3-one

Sign In for Pricing
View Details
Anti-SARS-CoV Nucleoprotein / NP Monolonal Antibody
E-AB-V1341-01 20 µL

Anti-SARS-CoV Nucleoprotein / NP Monolonal Antibody

Sign In for Pricing
View Details
Anti-SARS-CoV Nucleoprotein / NP Monolonal Antibody
E-AB-V1341-02 100 µL

Anti-SARS-CoV Nucleoprotein / NP Monolonal Antibody

Sign In for Pricing
View Details
hnRNP F (HNRNPF) (NM_001098206) Human Recombinant Protein
TP317995 20 µg

hnRNP F (HNRNPF) (NM_001098206) Human Recombinant Protein

Sign In for Pricing
View Details