Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTERF2 Peptide - N-terminal region

MTERF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MTERFL, MTERFD3

UniProt

Q49AM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTERF2 Rabbit Polyclonal Antibody (orb586708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079474

Preservative

Lyophilized powder

AA Sequence

TAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D11]
TA810947AM 100 µL

ZKSCAN1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D11]

Sign In for Pricing
View Details
Granulocyte Marker (BM-1), CF594 conjugate, 0.1mg/mL
BNC940061-100 1x 100 µL

Granulocyte Marker (BM-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
CF812019 100 µg

Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]

Sign In for Pricing
View Details
Vmn2r72 Mouse Gene Knockout Kit (CRISPR)
KN519203 1 Kit

Vmn2r72 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/3125R), CF647 conjugate, 0.1mg/mL
BNC473125-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/3125R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1131), CF740 conjugate, 0.1mg/mL
BNC741131-500 1x 500 µL

CD45RA (PTPRC/1131), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details