Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTERF2 Peptide - N-terminal region

MTERF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MTERFL, MTERFD3

UniProt

Q49AM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTERF2 Rabbit Polyclonal Antibody (orb586708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079474

Preservative

Lyophilized powder

AA Sequence

TAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C Rabbit Polyclonal Antibody
R1510-41 100 µL

Cytochrome C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOXHD1 (NM_001145473) Human Over-expression Lysate
LC428913 20 µg

LOXHD1 (NM_001145473) Human Over-expression Lysate

Sign In for Pricing
View Details
HMGB1 Antibody
8C10316-AAT 50 µg

HMGB1 Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]
E-AB-F1242M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]
E-AB-F1242M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]
E-AB-F1242M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details