Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYSM1 Peptide - C-terminal region

MYSM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2A-DUB, 2ADUB, DKFZp779J1554, DKFZp779J1721, KIAA1915, RP4-592A1.1

UniProt

Q5VVJ2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYSM1 Rabbit Polyclonal Antibody (orb586709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078956

Preservative

Lyophilized powder

AA Sequence

CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MAPK14 shRNA (UAS) - Lentiviral human MAPK14 shRNA (UAS, GFP) (25)
GTR15326711 1 Vial

Lentiviral human MAPK14 shRNA (UAS) - Lentiviral human MAPK14 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
ADAM10 Recombinant Monoclonal Antibody
A78404-50UL 50 μL

ADAM10 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
C8orf55 CRISPR Knock Out 293T Cell Line (Human)
14742141 1x 10^6 Cells / 1.0 mL

C8orf55 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
S100P Antibody
E30AC1208 100 µL

S100P Antibody

Sign In for Pricing
View Details
Flt3 ligand, NT (FLT3LG, Fms-related tyrosine kinase 3 ligand, FL, FLT3L)
350618 100 µg

Flt3 ligand, NT (FLT3LG, Fms-related tyrosine kinase 3 ligand, FL, FLT3L)

Sign In for Pricing
View Details
Phospho-BAD(S124) Antibody Blocking peptide
MBS9225272-01 0.5 mg

Phospho-BAD(S124) Antibody Blocking peptide

Sign In for Pricing
View Details