Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYSM1 Peptide - C-terminal region

MYSM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2A-DUB, 2ADUB, DKFZp779J1554, DKFZp779J1721, KIAA1915, RP4-592A1.1

UniProt

Q5VVJ2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYSM1 Rabbit Polyclonal Antibody (orb586709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078956

Preservative

Lyophilized powder

AA Sequence

CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC680026 3'UTR GFP Stable Cell Line
TU260534 1.0 mL

LOC680026 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ITGA1 ELISA Kit (Human) (OKEH08740)
OKEH08740 96 Well

ITGA1 ELISA Kit (Human) (OKEH08740)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)
MBS1420502-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)
MBS1420502-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)
MBS1420502-03 0.02 mg (Yeast)

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)
MBS1420502-04 0.1 mg (Yeast)

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yotI (yotI)

Sign In for Pricing
View Details