Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYSM1 Peptide - N-terminal region

MYSM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2A-DUB, 2ADUB, DKFZp779J1554, DKFZp779J1721, KIAA1915, RP4-592A1.1

UniProt

Q5VVJ2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYSM1 Rabbit Polyclonal Antibody (orb586710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078956

Preservative

Lyophilized powder

AA Sequence

KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHOX2B Rabbit pAb
MBS8547613-01 0.1 mL

PHOX2B Rabbit pAb

Sign In for Pricing
View Details
PHOX2B Rabbit pAb
MBS8547613-02 0.1 mL (AF405L)

PHOX2B Rabbit pAb

Sign In for Pricing
View Details
PHOX2B Rabbit pAb
MBS8547613-03 0.1 mL (AF405S)

PHOX2B Rabbit pAb

Sign In for Pricing
View Details
PHOX2B Rabbit pAb
MBS8547613-04 0.1 mL (AF610)

PHOX2B Rabbit pAb

Sign In for Pricing
View Details
PHOX2B Rabbit pAb
MBS8547613-05 0.1 mL (AF635)

PHOX2B Rabbit pAb

Sign In for Pricing
View Details
PHOX2B Rabbit pAb
MBS8547613-06 0.1 mL (APC)

PHOX2B Rabbit pAb

Sign In for Pricing
View Details