Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYSM1 Peptide - N-terminal region

MYSM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2A-DUB, 2ADUB, DKFZp779J1554, DKFZp779J1721, KIAA1915, RP4-592A1.1

UniProt

Q5VVJ2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYSM1 Rabbit Polyclonal Antibody (orb586710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078956

Preservative

Lyophilized powder

AA Sequence

KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Culture Medium for Human Gastric Cancer Cells [snu-1]
AFG-ELL-1668-01 125 mL

Culture Medium for Human Gastric Cancer Cells [snu-1]

Sign In for Pricing
View Details
Culture Medium for Human Gastric Cancer Cells [snu-1]
AFG-ELL-1668-02 500 mL

Culture Medium for Human Gastric Cancer Cells [snu-1]

Sign In for Pricing
View Details
TFIIIC220 (F-12) FITC
sc-398780 FITC 200 µg/mL

TFIIIC220 (F-12) FITC

Sign In for Pricing
View Details
DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)
MBS6216615-01 0.1 mL

DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)

Sign In for Pricing
View Details
DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)
MBS6216615-02 5x 0.1 mL

DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)

Sign In for Pricing
View Details
Chelidonic acid
T5558-01 1 mL - 10 mM (in DMSO)

Chelidonic acid

Sign In for Pricing
View Details