Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NADSYN1 Peptide - C-terminal region

NADSYN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10631, FLJ36703, FLJ40627

UniProt

Q6IA69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NADSYN1 Rabbit Polyclonal Antibody (orb326642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060631

Preservative

Lyophilized powder

AA Sequence

PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM1A Antibody
KC-2783-01 50 μL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
KC-2783-02 100 µL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
KC-2783-03 1 mL

KDM1A Antibody

Sign In for Pricing
View Details
PSMC2 (NM_002803) Human Over-expression Lysate
LY400991 100 µg

PSMC2 (NM_002803) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C9orf167 (TOR4A) activation kit by CRISPRa
GA110322 1 Kit

Human C9orf167 (TOR4A) activation kit by CRISPRa

Sign In for Pricing
View Details
Atogepant-D4 (major)
TRC-A874349-5MG 5 mg

Atogepant-D4 (major)

Sign In for Pricing
View Details