Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY6 Peptide - N-terminal region

P2RY6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC15335, P2Y6

UniProt

Q15077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY6 Rabbit Polyclonal Antibody (orb586714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789767

Preservative

Lyophilized powder

AA Sequence

NLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nup210l siRNA Oligos set (Rat)
32323176 3x 5 nmol

Nup210l siRNA Oligos set (Rat)

Sign In for Pricing
View Details
FLJ13231 siRNA (h)
sc-92028 10 µM

FLJ13231 siRNA (h)

Sign In for Pricing
View Details
Recombinant Mouse Coagulation Factor XI (F11)
RPU55722-01 50 µg

Recombinant Mouse Coagulation Factor XI (F11)

Sign In for Pricing
View Details
Recombinant Mouse Coagulation Factor XI (F11)
RPU55722-02 100 µg

Recombinant Mouse Coagulation Factor XI (F11)

Sign In for Pricing
View Details
Recombinant Mouse Coagulation Factor XI (F11)
RPU55722-03 1 mg

Recombinant Mouse Coagulation Factor XI (F11)

Sign In for Pricing
View Details
Anti-Chlamydia trachomatis MOMP Antibody
15103-1000 1mg

Anti-Chlamydia trachomatis MOMP Antibody

Sign In for Pricing
View Details