Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY6 Peptide - N-terminal region

P2RY6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC15335, P2Y6

UniProt

Q15077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY6 Rabbit Polyclonal Antibody (orb586714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789767

Preservative

Lyophilized powder

AA Sequence

NLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heparin disaccharide III-S trisodium salt
297217-01 1 mg

Heparin disaccharide III-S trisodium salt

Sign In for Pricing
View Details
Heparin disaccharide III-S trisodium salt
297217-02 2 mg

Heparin disaccharide III-S trisodium salt

Sign In for Pricing
View Details
Heparin disaccharide III-S trisodium salt
297217-03 5 mg

Heparin disaccharide III-S trisodium salt

Sign In for Pricing
View Details
Heparin disaccharide III-S trisodium salt
297217-04 10 mg

Heparin disaccharide III-S trisodium salt

Sign In for Pricing
View Details
Heparin disaccharide III-S trisodium salt
297217-05 25 mg

Heparin disaccharide III-S trisodium salt

Sign In for Pricing
View Details
5-Bromo-3-ethyl-isoxazole
PCC96174-01 50 mg

5-Bromo-3-ethyl-isoxazole

Sign In for Pricing
View Details