Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HA3 Peptide - N-terminal region

P4HA3 Peptide - N-terminal region

Product Specifications

UniProt

Q7Z4N8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P4HA3 Rabbit Polyclonal Antibody (orb586715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_878907

Preservative

Lyophilized powder

AA Sequence

EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-500 1x 500 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF488A conjugate, 0.1mg/mL
BNC882624-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF488A conjugate, 0.1mg/mL
BNC882988-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF568 conjugate, 0.1mg/mL
BNC680416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details