Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP2 Peptide - C-terminal region

PPFIBP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cclp1, DKFZp781K06126, MGC42541

UniProt

Q8ND30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPFIBP2 Rabbit Polyclonal Antibody (orb331366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003612

Preservative

Lyophilized powder

AA Sequence

LAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf80 (INIP) (NM_021218) Human Over-expression Lysate
LH11455V 100 µg

C9orf80 (INIP) (NM_021218) Human Over-expression Lysate

Sign In for Pricing
View Details
Betaine
N1709-1000000 1 Kg

Betaine

Sign In for Pricing
View Details
Gasdermin B (Gasdermin-B, GSDMB, Gasdermin-like Protein, GSDML, PP4052, PRO2521) (MaxLight 405)
MBS6190287-01 0.1 mL

Gasdermin B (Gasdermin-B, GSDMB, Gasdermin-like Protein, GSDML, PP4052, PRO2521) (MaxLight 405)

Sign In for Pricing
View Details
Gasdermin B (Gasdermin-B, GSDMB, Gasdermin-like Protein, GSDML, PP4052, PRO2521) (MaxLight 405)
MBS6190287-02 5x 0.1 mL

Gasdermin B (Gasdermin-B, GSDMB, Gasdermin-like Protein, GSDML, PP4052, PRO2521) (MaxLight 405)

Sign In for Pricing
View Details
Chk2 (Ab-33) Antibody
E021527-1 50 µg - 50 µL

Chk2 (Ab-33) Antibody

Sign In for Pricing
View Details
Recombinant Dog APOC1 protein, N-His-GST Tag
IMP-3752 10 µg

Recombinant Dog APOC1 protein, N-His-GST Tag

Sign In for Pricing
View Details