PPFIBP2 Peptide - C-terminal region
PPFIBP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Cclp1, DKFZp781K06126, MGC42541
UniProt
Q8ND30
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPFIBP2 Rabbit Polyclonal Antibody (orb331366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003612
Preservative
Lyophilized powder
AA Sequence
LAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9361377-01 48 Well
Hamster Zinc Finger Protein GLI2 (GLI2) ELISA Kit
Sign In for Pricing
View Details MBS9361377-02 96 Well
Hamster Zinc Finger Protein GLI2 (GLI2) ELISA Kit
Sign In for Pricing
View Details MBS9361377-03 5x 96 Well
Hamster Zinc Finger Protein GLI2 (GLI2) ELISA Kit
Sign In for Pricing
View Details MBS9361377-04 10x 96 Well
Hamster Zinc Finger Protein GLI2 (GLI2) ELISA Kit
Sign In for Pricing
View Details 