PPP1R9A Peptide - N-terminal region
PPP1R9A Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ20068, KIAA1222, NRB1, NRBI, Neurabin-I
UniProt
B2RWQ1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1R9A Rabbit Polyclonal Antibody (orb326645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001159632
Preservative
Lyophilized powder
AA Sequence
GERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400807-100 1x 100 µL
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882098-500 1x 500 µL
Catenin, beta (CTNNB1) (CTNNB1/2098), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471422-500 1x 500 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 